Protein Info for AO356_15435 in Pseudomonas fluorescens FW300-N2C3

Annotation: hydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08543: Phos_pyr_kin
  • amino acids 17 to 253 (237 residues), 236.9 bits, E=1.2e-74

Best Hits

Swiss-Prot: 32% identical to THID_STAAS: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Staphylococcus aureus (strain MSSA476)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 99% identity to pba:PSEBR_a4939)

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7)" (EC 2.7.4.7)

MetaCyc Pathways

• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis I (2/2 steps found)
• hydroxymethylpyrimidine salvage (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate salvage IV (yeast) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

See A0A0N9X077 at UniProt or InterPro

Protein Sequence (265 amino acids)

>AO356_15435 hydrogenase (Pseudomonas fluorescens FW300-N2C3)
MNIYSSRPVVLCLSGHDPSGGAGLQADIEALLAQGCHAAPAVTALTVQDTVNVSDFRVLD
REWVLAQANAVLNDSPVAAVKLGMLGSLEMVDTVVELLQAHPHLPMVCDPVLRAGGGGRL
GKDEVGYAMRERLLPLAIIATPNLPEARILAELPEGSADECAEKLLPFVKHLLITGGHGD
EHEVHNRLYSRDGRRETFTCQRLPGSYHGSGCTLASALAGRLAQGEQLASAVKTALDYTW
RTLRDAEQLGKGQFVPRRLPLDFCS