Protein Info for AO356_13875 in Pseudomonas fluorescens FW300-N2C3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 42% identity to reu:Reut_C6119)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WVS5 at UniProt or InterPro

Protein Sequence (258 amino acids)

>AO356_13875 hypothetical protein (Pseudomonas fluorescens FW300-N2C3)
MLSLTALPLYGLAIFIAIVAGIEAGRRIGNRHLAQDPEGARQGIGAIEGAVFGLLALLIA
FTFSGAATRLDQRRALIVAETNAMGTAWLRLDLLPASEQPAVRQAFKDYVDARIEYYRDL
REDELDEAAHDRASDLQQTIWKRTIAALQQMPTPTLGVSVLQAQNEMIDITTTRAVAHET
HPPLVIYLMLVTMALISALLIGYGMAGTKRRNWLHSLGYAAVMVCVLYVILDFEYPRFGV
IRVDYFDKIMLDLRQSMN