Protein Info for AO356_13805 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): ABC transporter for Carnitine, ATPase component
Rationale: Specific phenotype on Carnitine Hydrochloride. Likely to be a choline or glycine betaine transporter as well (with AO356_13855 as the SBP)
Original annotation: choline ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 TIGR03415: choline ABC transporter, ATP-binding protein" amino acids 4 to 389 (386 residues), 611.6 bits, see alignment E=5.4e-188 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 36 to 288 (253 residues), 326.6 bits, see alignment E=2e-101 PF00005: ABC_tran" amino acids 44 to 195 (152 residues), 108.5 bits, see alignment E=4.5e-35

Best Hits

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 95% identity to pba:PSEBR_a5245)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.32

Use Curated BLAST to search for 3.6.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WRY0 at UniProt or InterPro

Protein Sequence (392 amino acids)

>AO356_13805 ABC transporter for Carnitine, ATPase component (Pseudomonas fluorescens FW300-N2C3)
MSIIRFEDVDVIFSNRPKAALDLLDKGFSRPEILQQTGLIVGVEKASLSIEKGEICVLMG
LSGSGKSSLLRCINGLNTVSRGKLFVEHEGRQIDIASCSPAELKMMRTKRIAMVFQKFAL
MPWLTVRENISFGLEMQGRPEKERRKLVDEKLELVGLTQWRNKKPDELSGGMQQRVGLAR
ALAMDADILLMDEPFSALDPLIRQGLQDELLELQRKLQKTIVFVSHDLDEALKLGTRIAI
MKDGKIIQYSKPEEIVLNPADDYVRTFVAHTNPLNVLCGRSLMRTLDNCKRINGSVCLDP
GGDSWLDLAEGNTIKGARQNGAVLDLQNWAPGQSVEELGRRPTLVDSNIGMRDALQIRYQ
TGNKLVLHDNQKVVGILGDSELYHALLGKNLG