Protein Info for AO356_13610 in Pseudomonas fluorescens FW300-N2C3

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF05221: AdoHcyase" amino acids 12 to 150 (139 residues), 243.1 bits, see alignment E=3.9e-76 amino acids 149 to 468 (320 residues), 168.9 bits, see alignment E=1.5e-53 TIGR00936: adenosylhomocysteinase" amino acids 13 to 461 (449 residues), 503.5 bits, see alignment E=2.3e-155 PF00670: AdoHcyase_NAD" amino acids 199 to 381 (183 residues), 187.7 bits, see alignment E=1.7e-59

Best Hits

Swiss-Prot: 97% identical to SAHH_PSEPF: Adenosylhomocysteinase (ahcY) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 99% identity to pba:PSEBR_a5283)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WZE0 at UniProt or InterPro

Protein Sequence (469 amino acids)

>AO356_13610 adenosylhomocysteinase (Pseudomonas fluorescens FW300-N2C3)
MSAVITPAAFTDYKVADISLAAWGRREIIIAESEMPALMGLRRKYSGEQPLKGAKILGCI
HMTIQTAVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIPVFAWKGETEQEYEWCL
EQTILKDGQPWDTNMILDDGGDLTELLHKKYASVLENVHGVTEETTTGVHRLLDMLAKGE
LKIPAINVNDSVTKSKNDNKYGCRHSLNDAIKRGTDHLLSGKQALVIGYGDVGKGSSQSL
RQEGMIVKVSEVDPICAMQACMDGFELVSPFIDGINDGTEASIDKALLGKIDLIVTTTGN
VNVCDANMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWEEVKPQVHKVHRTGTGSFDPQ
NDDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQIFLFGQKYADLSPAQKAERLTV
EVLPKKLDEEVALEMVRGFGGVVTKLTKQQADYIGVTVEGPFKPHAYRY