Protein Info for AO356_13575 in Pseudomonas fluorescens FW300-N2C3

Annotation: amine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00890: FAD_binding_2
  • amino acids 30 to 69 (40 residues), 30 bits, 1.2e-10
• PF01266: DAO
  • amino acids 31 to 271 (241 residues), 56.2 bits, E=1.6e-18
• PF13450: NAD_binding_8
  • amino acids 32 to 66 (35 residues), 37.5 bits, see alignment (E = 8.1e-13)
• PF01593: Amino_oxidase
  • amino acids 37 to 452 (416 residues), 171 bits, E=2e-53

Best Hits

KEGG orthology group: K00274, monoamine oxidase [EC: 1.4.3.4] (inferred from 93% identity to pba:PSEBR_a5290)

Predicted SEED Role

"Amine oxidase [flavin-containing] (EC 1.4.3.4)" (EC 1.4.3.4)

MetaCyc Pathways

• phenylethylamine degradation I (2/2 steps found)
• putrescine degradation III (3/4 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• salidroside biosynthesis (2/4 steps found)
• serotonin degradation (4/7 steps found)
• L-tryptophan degradation VI (via tryptamine) (1/3 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• dopamine degradation (2/5 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• aromatic biogenic amine degradation (bacteria) (4/8 steps found)
• melatonin degradation II (1/4 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (4/9 steps found)
• superpathway of phenylethylamine degradation (5/11 steps found)
• superpathway of melatonin degradation (1/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Arginine and proline metabolism
• Drug metabolism - cytochrome P450
• Glycine, serine and threonine metabolism
• Histidine metabolism
• Phenylalanine metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.4

Sequence Analysis Tools

See A0A0N7H256 at UniProt or InterPro

Protein Sequence (588 amino acids)

>AO356_13575 amine oxidase (Pseudomonas fluorescens FW300-N2C3)
MSAGWLRACALVMIGLFSVSALAKDKQPTAIVIGGGLAGLTAAYELQNKGWAVTLLEAKP
DLGGRSGMATSEWIGNEKTQPVLNKYVSAFKLSTTPAPEFVRTPSYLIDGTYFTAADLAT
KQPATAEALKRYETTLDDLARSIEDPQNPAANNTLHALDQITVSNWLDRLQLPATARQLV
NQEIRTRYDEPSRLSLLYFAQQNRVYRGVSDRDLRASRLLGGSPTLAQAFVKQLKTIKTN
SPVSAISQDKDGVTVKVGSVGYQADYVVLAVPLRALNKIQLTPALDAQHQGAIKGTNYGW
RDQIMLKFKTPVWDSKARMSGEIYSNAGLGMMWIEPAMKGGANVVINLSGDNARVMQAFG
DKQMVDQVLIRLHAFYPQARGAFTGYEIRRYSTDPSTGGAYLAFGPGQISKYWRLWEKPL
QRVAFAGEHTDTLYPGTLEGALRSGQRAASQVEDLAAGKSFEPAKVAPAATAAAAGAVAA
KKGNFFSNLFGGSDDDKKPEPVKAPEPVAPAPTPAPAPVPAPAPAPAPVEAPKAAAPVKA
EPAKKASAKKPAAKTPAKKAPAKAPVKKTEPAKKPAAKPATTTETKVQ