Protein Info for AO356_13340 in Pseudomonas fluorescens FW300-N2C3

Annotation: signal recognition particle-docking protein FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF02881: SRP54_N" amino acids 187 to 252 (66 residues), 53.5 bits, see alignment E=4.7e-18 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 201 to 471 (271 residues), 367.1 bits, see alignment E=2.7e-114 PF06414: Zeta_toxin" amino acids 266 to 377 (112 residues), 35.9 bits, see alignment E=1.1e-12 PF01583: APS_kinase" amino acids 270 to 318 (49 residues), 21.5 bits, see alignment 3.8e-08 PF00448: SRP54" amino acids 271 to 471 (201 residues), 261.2 bits, see alignment E=1.2e-81

Best Hits

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 96% identity to pba:PSEBR_a5338)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WI24 at UniProt or InterPro

Protein Sequence (477 amino acids)

>AO356_13340 signal recognition particle-docking protein FtsY (Pseudomonas fluorescens FW300-N2C3)
MFGSNDDKKTPAAAGEKKGLFGWLRKKPQDTVVEQPQALPEPAAEAVAEEAAPIVLPIAE
PVLQPVEPEPVAEPMAEQPLTPPAEQTPWLTLPVAEEPVALVEETAPHITPPIPAPTQVV
EAPVVEAVIEPPAAVVAPVVAPAAPEPVPAVLETMAPVEPVRSAEENKVGFFARLKQGLS
KTSASIGEGMASLFLGKKVIDDELLEDIETRLLTADVGVEATSVIIQSLTQKVARKQLTD
ADALYKSLQGELTSLLKPVEKPLVIASQNKPFVILVVGVNGAGKTTTIGKLAKKLQLEGK
KVMLAAGDTFRAAAVEQLQVWGERNKIPVIAQHTGADSASVIFDAVQAAKARGIDVLIAD
TAGRLHTKDNLMEELKKVRRVIGKLDADAPHEVLLVLDAGTGQNAINQAKQFNQTVELTG
LALTKLDGTAKGGVIFALAKQFGLPIRYIGVGEGIDDLRTFEAEPFVQALFAEREHS