Protein Info for AO356_13140 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)
Rationale: Specifically important for: Putrescine Dihydrochloride. this is part of the gamma-glutamyl-putrescine pathway for putrescine catabolism (SEED_correct)
Original annotation: gamma-glutamyl-gamma-aminobutyrate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF07722: Peptidase_C26" amino acids 5 to 223 (219 residues), 248.8 bits, see alignment E=5.4e-78 PF00117: GATase" amino acids 82 to 233 (152 residues), 51.4 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 95% identity to pba:PSEBR_cmegl97)

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W325 at UniProt or InterPro

Protein Sequence (258 amino acids)

>AO356_13140 Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94) (Pseudomonas fluorescens FW300-N2C3)
MSRLPLIGVTTCSRQMGLHAYHTSGDKYARAVATAAKGLPVLVPSLADLFPPSDILDALD
GILLTGSPSNVEPFHYQGPASAPGTAHDPARDATTLPLIRAAVEAGVPVLGICRGFQEMN
VAFGGSLHQKVHEVGTFIDHREDDTQAVEVQYGPAHAVDIQPGGILAGLGLPQSIEVNSI
HSQGIERLAPGLRAEAVAPDGLIEAVSVPEGKAFALGVQWHPEWEVSSNPHYLAIFQAFG
DACRARATQRDADASNNA