Protein Info for AO356_13015 in Pseudomonas fluorescens FW300-N2C3

Annotation: 2-octaprenyl-6-methoxyphenyl hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 5 to 336 (332 residues), 73.5 bits, E=1.9e-24
• TIGR01984: 2-polyprenyl-6-methoxyphenol 4-hydroxylase
  • amino acids 5 to 388 (384 residues), 451.2 bits, E=2.7e-139
• TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family
  • amino acids 6 to 388 (383 residues), 409.2 bits, E=1.6e-126

Best Hits

KEGG orthology group: K03185, 2-octaprenyl-6-methoxyphenol hydroxylase [EC: 1.14.13.-] (inferred from 97% identity to pba:PSEBR_a5431)

MetaCyc: 35% identical to 2-methoxy-6-(all-trans-polyprenyl)phenol 4-hydroxylase (Xanthomonas campestris pv. campestris)
1.14.13.M56 [EC: 1.14.13.M56]

Predicted SEED Role

"2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (11/12 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (7/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (5/9 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Bisphenol A degradation
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Cyanoamino acid metabolism
• Flavonoid biosynthesis
• Histidine metabolism
• Isoflavonoid biosynthesis
• Limonene and pinene degradation
• Methane metabolism
• Naphthalene and anthracene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Styrene degradation
• Toluene and xylene degradation
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.M56

Sequence Analysis Tools

See A0A0N9W308 at UniProt or InterPro

Protein Sequence (395 amino acids)

>AO356_13015 2-octaprenyl-6-methoxyphenyl hydroxylase (Pseudomonas fluorescens FW300-N2C3)
MSRVNLAIIGGGLVGASLALALQAGAKARGWRIILIEPFAPGDAWQPSYDARSSALSYGA
RQIYQRLGVWQEISRRAEPIKQIHVSDRGRFSTARLSAMEEGVPALGYVVENAWLGQCLW
QGLDPEVVSWRCPAQVTRMEPLVGGYRLTLDDETTLECDLAVLADGGRSSLREQLGVGVR
SRPYDQSALIANITPSEAHNGMAFERFTDDGPMALLPLPENRCALVWTRQGMDAQRLAAL
DERSFLAELQGVFGYRLGTLKQVGVRHLYPLALVEAEEQVRPHLAILGNAAHSLHPIAGQ
GFNLSLRDAQALADALLDSDREPGDFAVLQAYRESQRMDQALTVGFSDQVTRLFGSSLPL
VSLGRNLGLLGLDLLPPAKRWFARQAMGLGTRPDA