Protein Info for AO356_12815 in Pseudomonas fluorescens FW300-N2C3

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01346: FKBP_N" amino acids 29 to 121 (93 residues), 56.2 bits, see alignment E=5.1e-19 PF00254: FKBP_C" amino acids 134 to 217 (84 residues), 80.9 bits, see alignment E=7.3e-27

Best Hits

Swiss-Prot: 51% identical to FKBZ_PSEAE: Probable FKBP-type 25 kDa peptidyl-prolyl cis-trans isomerase (fkl) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03773, FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC: 5.2.1.8] (inferred from 96% identity to pba:PSEBR_a5471)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X918 at UniProt or InterPro

Protein Sequence (221 amino acids)

>AO356_12815 peptidylprolyl isomerase (Pseudomonas fluorescens FW300-N2C3)
MSRHLFLFLCMACATVQAVEKTSANDAHDLAYSLGASLGERLRQDVPDLQIKALVEGLQQ
AYLGKPLALKDERIEQILAEHQAQLNAPSTTPQDEAALKTEQKFLTEEKNRPGVQQLADG
ILLTEIKPGHGAKAGPHGKVQVLYTGRLPDGTVFDSNRQAQWFNLDSVIDGWRTALPQMP
VGAKWRLVIPSSLAYGAEGAGDVIPPYTPLVFEIELLGATT