Protein Info for AO356_12590 in Pseudomonas fluorescens FW300-N2C3

Annotation: phospholipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13091: PLDc_2
  • amino acids 72 to 224 (153 residues), 49.3 bits, E=4.4e-17
  • amino acids 323 to 462 (140 residues), 61.7 bits, E=6.7e-21

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a5514)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

• cardiolipin biosynthesis II (3/3 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism
• High-mannose type N-glycan biosynthesis
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

See A0A0N7H233 at UniProt or InterPro

Protein Sequence (521 amino acids)

>AO356_12590 phospholipase (Pseudomonas fluorescens FW300-N2C3)
VRSRPILPALLLVGSLLSGCAGLDVTREPSQALPATESSFGRSVQAQAAAHEGRSGFRLL
SDSTEAFTARAELIRHAQGSLDLQYYIVHDGISTRMLVDELLKAADRGVRVRILLDDTTS
DGQDQIIATLAAHPQIQIRLFNPLHLGRATGVTRGLGRLFDLSLQHRRMHNKLWLADNSM
AIVGGRNLGDEYFDAEPNLNFTDIDLLSVGPVAEQLGHSFDQYWNSALSKPIEQFLSHRP
TPKDLANSRLRLQESLEQTHKENHALYQQLTAYKTQPRLDTWRDQLIWAWNQALWDAPSK
VLAKDEPDPQLLLTTQLAPELTGVSKELIMISAYFVPGQPGLVYLTSRADAGVSVSLLTN
SLEATDVPAVHGGYAPYRKALLQHGVRLFELRRQPGDTGGSPHLFYSKSYGESDSSLHSK
AIIFDQQKSFIGSFNFDPRSVLWNTEVGVLVDSPELAGQVRELALQGMAPALSYQARLKD
GKLVWTTEDNGKIHDLDREPGSWWRRFNAWFATTVGLERML