Protein Info for AO356_12575 in Pseudomonas fluorescens FW300-N2C3

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF05899: Cupin_3" amino acids 41 to 113 (73 residues), 90 bits, see alignment E=3.2e-30

Best Hits

KEGG orthology group: K06995, (no description) (inferred from 98% identity to pba:PSEBR_a5517)

Predicted SEED Role

"FIG00953403: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WYY1 at UniProt or InterPro

Protein Sequence (120 amino acids)

>AO356_12575 transcriptional regulator (Pseudomonas fluorescens FW300-N2C3)
MSIQDIVDFSQANTTAERYRPDPAKVFKGDPEQTVFNHYSSPCGQMNAGVWEGAVGQWTV
NYTEHEYCEIVQGVSVLRDNDGNAKTLRAGDRFVIPAGFKGTWEVLEPCRKIYVVFEAKL