Protein Info for AO356_11935 in Pseudomonas fluorescens FW300-N2C3
Annotation: GTP cyclohydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 76% identical to GCH4_PSEF5: GTP cyclohydrolase FolE2 (folE2) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
KEGG orthology group: K09007, hypothetical protein (inferred from 89% identity to pba:PSEBR_a5608)Predicted SEED Role
"GTP cyclohydrolase I (EC 3.5.4.16) type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)
MetaCyc Pathways
- superpathway of chorismate metabolism (44/59 steps found)
- superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
- superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
- tetrahydromonapterin biosynthesis (3/4 steps found)
- drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
- erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
- threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
- preQ0 biosynthesis (2/4 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.5.4.16
Use Curated BLAST to search for 3.5.4.16
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N7H217 at UniProt or InterPro
Protein Sequence (298 amino acids)
>AO356_11935 GTP cyclohydrolase (Pseudomonas fluorescens FW300-N2C3) MNALTLPDVAAQVSHQTLPLDWVGMCGIATPVLIDGQRLSATVDAGVSLDDSEARGIHMS RLYLALGLLEETPLSPALLRRILEQFLDSHEGLSHAASLSVHTNLLLKRPALISPLAGWK GYPVSIEAQLKNTMFHVELKIQIPYSSTCPCSAALARQLIQQQFVDDFANKKLEHAEILA WLGSSNGIVATPHSQRSTATLTLRLDTAVDELPLQSFINQAEAALGTAVQTAVKRADEQA FALANGQNLMFCEDAARRLSTALARSSEITALDVRVVHAESLHAHDAVAQSRWTREPS