Protein Info for AO356_11560 in Pseudomonas fluorescens FW300-N2C3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Best Hits

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a18)

Predicted SEED Role

"NAD-specific glutamate dehydrogenase (EC 1.4.1.2), large form" in subsystem Glutamate dehydrogenases or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.2)

MetaCyc Pathways

• L-alanine degradation II (to D-lactate) (3/3 steps found)
• L-glutamate degradation I (1/1 steps found)
• ethene biosynthesis IV (engineered) (1/3 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
• L-glutamate degradation XI (reductive Stickland reaction) (3/7 steps found)
• 4-aminobutanoate degradation V (2/7 steps found)
• methylaspartate cycle (10/19 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.2

Use Curated BLAST to search for 1.4.1.2

Sequence Analysis Tools

See A0A0N9WWH9 at UniProt or InterPro

Protein Sequence (96 amino acids)

>AO356_11560 hypothetical protein (Pseudomonas fluorescens FW300-N2C3)
MNTFHKTLVGSLLALSLGNAFATSFDQPSFAEGGSDRLIEKRVAEGGSDRLIEKRVAEGG
SDRLIEKRVAEGGSDRLIEKRVAEGGSDRLMENRVG