Protein Info for AO356_11540 in Pseudomonas fluorescens FW300-N2C3

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF02798: GST_N" amino acids 15 to 91 (77 residues), 50.8 bits, see alignment E=5.1e-17 PF13417: GST_N_3" amino acids 23 to 96 (74 residues), 49.7 bits, see alignment E=1.1e-16 PF13409: GST_N_2" amino acids 25 to 92 (68 residues), 57.8 bits, see alignment E=4.1e-19 PF13410: GST_C_2" amino acids 147 to 212 (66 residues), 30.1 bits, see alignment E=1.3e-10 PF14497: GST_C_3" amino acids 156 to 224 (69 residues), 26.4 bits, see alignment E=2e-09 PF00043: GST_C" amino acids 160 to 216 (57 residues), 27.1 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 73% identical to GST2_YEAST: Glutathione S-transferase 2 (GTT2) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 77% identity to pfs:PFLU3417)

MetaCyc: 73% identical to glutathione transferase 2 monomer (Saccharomyces cerevisiae)
Glutathione transferase. [EC: 2.5.1.18]; 2.5.1.18 [EC: 2.5.1.18]

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WH85 at UniProt or InterPro

Protein Sequence (231 amino acids)

>AO356_11540 glutathione S-transferase (Pseudomonas fluorescens FW300-N2C3)
MTSPQQRVDVSTVPTMKIYDWFNGPYPARVRIALAEKGLLPNIEFVPVNLWAGEHKKPEF
LAINYSGTLPVLELDDGTRIAECTAITQYLDSLDGHPTLTGETPVEKGIIHMMTKRAEIE
FLDAVSAYFHHATPGLGPDVELYQNAEWGARMRDKAIRGMRYFDNLLKDRPFVAGDKFSM
ADIAVLGGMIFASLVQLPVPEECVALRAWHARMQERSSVQTWRAMVERGAA