Protein Info for AO356_11540 in Pseudomonas fluorescens FW300-N2C3

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 15 to 91 (77 residues), 50.8 bits, E=5.1e-17
• PF13417: GST_N_3
  • amino acids 23 to 96 (74 residues), 49.7 bits, E=1.1e-16
• PF13409: GST_N_2
  • amino acids 25 to 92 (68 residues), 57.8 bits, E=4.1e-19
• PF13410: GST_C_2
  • amino acids 147 to 212 (66 residues), 30.1 bits, E=1.3e-10
• PF14497: GST_C_3
  • amino acids 156 to 224 (69 residues), 26.4 bits, E=2e-09
• PF00043: GST_C
  • amino acids 160 to 216 (57 residues), 27.1 bits, E=1.3e-09

Best Hits

Swiss-Prot: 73% identical to GST2_YEAST: Glutathione S-transferase 2 (GTT2) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 77% identity to pfs:PFLU3417)

MetaCyc: 73% identical to glutathione transferase 2 monomer (Saccharomyces cerevisiae)
Glutathione transferase. [EC: 2.5.1.18]; 2.5.1.18 [EC: 2.5.1.18]

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See A0A0N9WH85 at UniProt or InterPro

Protein Sequence (231 amino acids)

>AO356_11540 glutathione S-transferase (Pseudomonas fluorescens FW300-N2C3)
MTSPQQRVDVSTVPTMKIYDWFNGPYPARVRIALAEKGLLPNIEFVPVNLWAGEHKKPEF
LAINYSGTLPVLELDDGTRIAECTAITQYLDSLDGHPTLTGETPVEKGIIHMMTKRAEIE
FLDAVSAYFHHATPGLGPDVELYQNAEWGARMRDKAIRGMRYFDNLLKDRPFVAGDKFSM
ADIAVLGGMIFASLVQLPVPEECVALRAWHARMQERSSVQTWRAMVERGAA