Protein Info for AO356_10945 in Pseudomonas fluorescens FW300-N2C3

Annotation: osmotically inducible protein OsmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 TIGR03562: peroxiredoxin, OsmC subfamily" amino acids 5 to 139 (135 residues), 204.3 bits, see alignment E=3.6e-65 PF02566: OsmC" amino acids 42 to 138 (97 residues), 76 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 61% identical to OSMC_ECOLI: Peroxiredoxin OsmC (osmC) from Escherichia coli (strain K12)

KEGG orthology group: K04063, osmotically inducible protein OsmC (inferred from 98% identity to pba:PSEBR_a139)

MetaCyc: 61% identical to osmotically inducible peroxiredoxin OsmC (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Osmotically inducible protein C"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WXR2 at UniProt or InterPro

Protein Sequence (143 amino acids)

>AO356_10945 osmotically inducible protein OsmC (Pseudomonas fluorescens FW300-N2C3)
MAIIKKASAHWEGDLKTGIGSISTETGVLREAPYGFKARFEGGKGTNPEELIGAAHAGCF
SMAFSMILGDAGLKADSIDTNAEVTLDQVEGGFAITAVKLVLKAKIPGASQAQFDELSKK
AKEGCPVSKVLNANITLDATLVS