Protein Info for AO356_10740 in Pseudomonas fluorescens FW300-N2C3

Annotation: RNA polymerase subunit sigma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF07638: Sigma70_ECF" amino acids 13 to 184 (172 residues), 25.5 bits, see alignment E=2.3e-09 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 25 to 183 (159 residues), 104 bits, see alignment E=3.3e-34 PF04542: Sigma70_r2" amino acids 28 to 94 (67 residues), 62.8 bits, see alignment E=4.1e-21 PF08281: Sigma70_r4_2" amino acids 129 to 176 (48 residues), 43.2 bits, see alignment E=5.1e-15 PF04545: Sigma70_r4" amino acids 133 to 181 (49 residues), 38.2 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 95% identity to pba:PSEBR_a172)

Predicted SEED Role

"RNA polymerase sigma-E factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W7H3 at UniProt or InterPro

Protein Sequence (190 amino acids)

>AO356_10740 RNA polymerase subunit sigma (Pseudomonas fluorescens FW300-N2C3)
MPAALDSPSDESLLARYRNGDGASFEVLYARHRQGLYRFLLSLSNKAELAEEVFQDTWLS
LIRSATQPQGRASFRTWLFQIARNRLIDHWRRQGVHNPLHDSYDEQLHVQPDDTGSPEQQ
LSLSRDQARLDAALQALPEDQREVFLLRLHGDLELPQIAALTGAPLETVKSRLRYAQQKL
QRLLAEEVPA