Protein Info for AO356_10635 in Pseudomonas fluorescens FW300-N2C3

Annotation: fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details PF00487: FA_desaturase" amino acids 67 to 331 (265 residues), 54.4 bits, see alignment E=8.4e-19

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a192)

Predicted SEED Role

"Fatty acid desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X878 at UniProt or InterPro

Protein Sequence (357 amino acids)

>AO356_10635 fatty acid desaturase (Pseudomonas fluorescens FW300-N2C3)
MHGTCASPERLNAQQRAAHIRQVVLARGEELRQCYPILRHQDALGAGILALALAGMIGSA
LLYINGYLAGWACLLLNGFFASLTHELEHDLIHSMYFRKQRLPHNLMMGLVWLARPSTIN
PWIRRHLHLNHHKVSGSEADMEERAITNGEPWGLARLLMVGDNVMSAFIRLLRAKTWVHK
RSILKRTLKVYFPLALLHWGAWYVFLGFHGANGVASLLGTSIDWSATTLATMQVIDIAAV
VIIGPNVLRTFCLHFVSSNMHYYGDIEPGNVIQQTQVLNPWWLWPLQAFCFNFGSSHGIH
HFVVKEPFYIRQLTVPVAHKVMREMGVRFNDFGTFGRANRFVRQEGVVREAGDTVRV