Protein Info for AO356_10535 in Pseudomonas fluorescens FW300-N2C3

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 282 (185 residues), 53.8 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 99% identity to pba:PSEBR_a213)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W1V4 at UniProt or InterPro

Protein Sequence (288 amino acids)

>AO356_10535 ABC transporter permease (Pseudomonas fluorescens FW300-N2C3)
MSQLSPAREEYEVDLQPLTHVPLERELPLGQRLWQQGWLRKSLILLLLAVVWEGVARYQN
NDLLLPSFLQTASALYDGLLSGELLGKVWISLVVLLKGYLLGIILAFGLTTLAVSTQLGR
DLLSTLTSMFNPLPAIALLPLALLWFGLGQNSLIFVLVHSVLWALALNMYSGFLGVSETL
RMAGRNYGLRGLRFVLFILIPAALPSILAGLKIGWAFAWRTLIAAELVFGATSGKGGLGW
YIFQNRNELYTDKVFAGLAVVILIGLLVENLVFDSLERVTVKRWGMQR