Protein Info for AO356_10220 in Pseudomonas fluorescens FW300-N2C3

Annotation: 3-ketoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00106: adh_short" amino acids 7 to 196 (190 residues), 186.8 bits, see alignment E=7.9e-59 PF01370: Epimerase" amino acids 10 to 172 (163 residues), 27.3 bits, see alignment E=6.1e-10 PF08659: KR" amino acids 10 to 169 (160 residues), 64.9 bits, see alignment E=2.3e-21 PF13561: adh_short_C2" amino acids 13 to 245 (233 residues), 212.8 bits, see alignment E=1.5e-66

Best Hits

Swiss-Prot: 39% identical to RDT1_ELSFA: Elsinochrome reductase 1 (RDT1) from Elsinoe fawcettii

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 96% identity to pba:PSEBR_a271)

MetaCyc: 43% identical to lyngbyatoxin A monooxygenase (Moorena producens)
1.14.13.-; 1.14.13.-

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W730 at UniProt or InterPro

Protein Sequence (246 amino acids)

>AO356_10220 3-ketoacyl-ACP reductase (Pseudomonas fluorescens FW300-N2C3)
MTVQNSKVAIVTGASRGIGAEIAKQLASEGFAVVINYANSATEASKLVVQLRQAGHQAIA
VKADVSSSADVRRMFDETEAKLGKVDVLINNAGILQVMPLAQHSDELFEQTFAINTRGTF
NTLREAATRLNDGGRIVNFSSSTVGLNLPGYSVYIASKAAVESLTQVFAKELRGRQITVN
AVAPGPVATELFMHGKSEEQVQHYAKMPPLERLGQPQDIASIIAFLVSPAAGWVNGQVLR
ANGGLV