Protein Info for AO356_09895 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): ABC transporter for L-Lysine, ATPase component
Rationale: Has weaker phenotypes on lysine than the other components, but is in an apparent operon and has the correct domain. Note that this organism has a second ABC transporter operon that is also important for lysine utilization, which is not explained.
Original annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00005: ABC_tran" amino acids 23 to 182 (160 residues), 123.7 bits, see alignment E=8.9e-40 PF13304: AAA_21" amino acids 111 to 212 (102 residues), 29.7 bits, see alignment E=6.4e-11

Best Hits

Swiss-Prot: 66% identical to AOTP_PSEAE: Arginine/ornithine transport ATP-binding protein AotP (aotP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to pba:PSEBR_a330)

Predicted SEED Role

"Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WX98 at UniProt or InterPro

Protein Sequence (257 amino acids)

>AO356_09895 ABC transporter for L-Lysine, ATPase component (Pseudomonas fluorescens FW300-N2C3)
MAQATPALEIRNLHKRYGQLEVLKGVSLTARDGDVISILGSSGSGKSTFLRCINLLENPN
QGQILVAGEELKLKAAKNGELVAADGKQINRLRSEIGFVFQNFNLWPHMSVLDNIIEAPR
RVLGQSKAEAVEVAEALLAKVGIADKRHAYPAELSGGQQQRAAIARTLAMQPKVILFDEP
TSALDPEMVQEVLSVIRALAEEGRTMLLVTHEMGFARQVSSEVVFLHQGLVEEQGSPQQV
FENPLSARCKQFMSSNR