Protein Info for AO356_09615 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): ABC transporter for L-Histidine, permease component
Rationale: Specific phenotypes on L-Histidine.
Original annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 139 to 166 (28 residues), see Phobius details amino acids 207 to 234 (28 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 110 to 272 (163 residues), 95.6 bits, see alignment E=1.6e-31

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to pba:PSEBR_a381)

Predicted SEED Role

"Histidine ABC transporter, permease protein (TC 3.A.1)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W6X3 at UniProt or InterPro

Protein Sequence (283 amino acids)

>AO356_09615 ABC transporter for L-Histidine, permease component (Pseudomonas fluorescens FW300-N2C3)
MFPESFTFSIADWVNGWVDSLVTNYGDVFRHISDTLLWAIVNLEGLLRMAPWWLMLAIVG
GIAWHATRKVLATAVIVGLLFLVGAVGLWDKLMQTLALMLVATLISVLIGIPLGILSARS
NRLRSVLMPLLDIMQTMPSFVYLIPVLMLFGLGKVPAIFATVIYAAPPLIRLTDLGIRQV
DGEVMEAINAFGANRWQQLFGVQLPLALPSIMAGINQTTMMALSMVVIASMIGARGLGED
VLVGIQTLNVGRGLEAGLAIVILAVVIDRITQAYGRPRHEVSK