Protein Info for AO356_09550 in Pseudomonas fluorescens FW300-N2C3

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 638 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details PF16591: HBM" amino acids 37 to 285 (249 residues), 158.3 bits, see alignment E=3.8e-50 PF00672: HAMP" amino acids 306 to 357 (52 residues), 45.9 bits, see alignment 8.8e-16 PF00015: MCPsignal" amino acids 420 to 604 (185 residues), 158.8 bits, see alignment E=1.9e-50

Best Hits

Swiss-Prot: 65% identical to MCPQ_PSEPK: Methyl-accepting chemotaxis protein McpQ (mcpQ) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 88% identity to pba:PSEBR_a394)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W6W7 at UniProt or InterPro

Protein Sequence (638 amino acids)

>AO356_09550 chemotaxis protein (Pseudomonas fluorescens FW300-N2C3)
MFRWLAQGLGNVSVNRKLGAGFGLVLFLTLMIAFTGWSSLGNVISRGDKLGFIASLNDLS
KDLNLASIDYNTTRGEKGPQAVNDLLGKLEAGLKTARELIEQPADVALIDKQLAAVAEYK
GAFAQMTRATVSREDARSKLGASADNAVARVAEVEKLMLQAGDVTSFNSVVTLSKAIQQA
RYQVRGYTYSGKSDAQQPALDAIDAVLKLLARLPDQLPQEHAANLQQASDSFNLYRAAVA
QFRDSQIDNAAALQRMSEQGQILMDASQKLTVSQTAVRDRDAAQAKMVLIVAAALALLFG
VIAALFITRQIVGPLGETLKVAERVAAGDLTHNLTSDRRDELGQLQRAMQSMTVGLRQLI
GGISEGVTQIASAAEQLSAVTEQTSAGVNSQKVETDQVATAMHEMTATVQEVARNAEEAS
EAAVAADQQAREGDKVVGEAIAQIERLAKEVGNSTAAMGDLKRESDKIGSVLDVIKSVAQ
QTNLLALNAAIEAARAGEAGRGFAVVADEVRSLAQRTQKSTEEIEELIVGLQAGTEQVAT
IMDNSRSLTDSSVELTRRAGGSLENITRTVSAIQSMNQQIAAAAEQQSAVAEEINRSVLN
VRDVSEQTASSSEETAASSAELARLGVHLQTLVGRFRV