Protein Info for AO356_09385 in Pseudomonas fluorescens FW300-N2C3

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR01357: 3-dehydroquinate synthase" amino acids 13 to 351 (339 residues), 384.4 bits, see alignment E=2.6e-119 PF00465: Fe-ADH" amino acids 15 to 181 (167 residues), 28.1 bits, see alignment E=1.5e-10 PF13685: Fe-ADH_2" amino acids 17 to 184 (168 residues), 42.8 bits, see alignment E=8.4e-15 PF01761: DHQ_synthase" amino acids 65 to 323 (259 residues), 356.8 bits, see alignment E=9e-111

Best Hits

Swiss-Prot: 96% identical to AROB_PSEF5: 3-dehydroquinate synthase (aroB) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 100% identity to pba:PSEBR_a428)

MetaCyc: 58% identical to 3-dehydroquinate synthase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate synthase. [EC: 4.2.3.4]

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.3.4

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W1F9 at UniProt or InterPro

Protein Sequence (366 amino acids)

>AO356_09385 3-dehydroquinate synthase (Pseudomonas fluorescens FW300-N2C3)
MQTLKVDLGERSYPIHIGEGLLDQPELLAPHIAGRQVAIISNETVAPLYLERLTRSLSAF
SVISVVLPDGEAFKNWETLQLIFDGLLTARHDRRTTVVALGGGVIGDMAGFAAACYQRGV
DFIQIPTTLLSQVDSSVGGKTGINHPLGKNMVGAFYQPNVVLIDTATLNTLPARELSAGL
AEVIKYGLICDEPFLGWLEEHVDRLRALDQAALTYAIERSCAAKAAVVGADERESGVRAT
LNLGHTFGHAIETHMGYGVWLHGEAVAAGTVMALEMSARLGWISEQERDRGIRLFQRAGL
PVVPPEEMSEADFLEHMAIDKKVIDGRLRLVLLRHMGEAVVTDDYPKEVLQATLGADYRA
LAQLKG