Protein Info for AO356_09050 in Pseudomonas fluorescens FW300-N2C3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 PF02696: SelO" amino acids 5 to 456 (452 residues), 501.6 bits, see alignment E=1.1e-154

Best Hits

Swiss-Prot: 88% identical to SELO_PSEF5: Protein adenylyltransferase SelO (selO) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a466)

MetaCyc: 52% identical to protein adenylyltransferase SelO (Escherichia coli K-12 substr. MG1655)
RXN0-7371 [EC: 2.7.7.108]

Predicted SEED Role

"Selenoprotein O and cysteine-containing homologs"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H1U9 at UniProt or InterPro

Protein Sequence (487 amino acids)

>AO356_09050 hypothetical protein (Pseudomonas fluorescens FW300-N2C3)
MKTLETLTFDNRFARLGDGFSAHVLPEPIDNPRLVVASPAAMALLNLDPAEAQAPLFAEI
FGGHKLWAETEPRAMVYSGHQFGHYNPQLGDGRGLLLGEVYNEAGEHWDLHLKGAGQTPF
SRMGDGRAVLRSSIREFLASEALHALGIPTTRALCVIGSDTPVWREKQERAAMVLRLAPS
HVRFGHFEYFYYTKKPELQAALAEHVLNLHFAECREQPEPYLAMFREIVERNAELIAKWQ
AYGFCHGVMNTDNMSILGITFDFGPFAFLDDFDANFICNHSDDQGRYSFSNQVPIGQWNL
SALAQALTPFISVDALRETLGLYLPLYQAHYLDLMRRRLGLTCAEEDDQKLLERLLQLMQ
NSGVDYSLFFRRLGDQAPEQAVSALRDDFVDLKGFDAWGELYVARVNREGPVNQDQRRAR
MHAVNPLYVLRNYLAQKAIDAAESGDYDEVRRLHAVLSKPFEEQPGMDSYAQRPPEWGKH
LEISCSS