Protein Info for AO356_08855 in Pseudomonas fluorescens FW300-N2C3

Annotation: adenylylsulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 98 to 117 (20 residues), see Phobius details TIGR00455: adenylyl-sulfate kinase" amino acids 19 to 195 (177 residues), 234.5 bits, see alignment E=3.6e-74 PF01583: APS_kinase" amino acids 34 to 186 (153 residues), 223.9 bits, see alignment E=1e-70 PF13671: AAA_33" amino acids 37 to 148 (112 residues), 40.3 bits, see alignment E=3.9e-14

Best Hits

Swiss-Prot: 57% identical to CYSC_SHEAM: Adenylyl-sulfate kinase (cysC) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 93% identity to pba:PSEBR_a500)

MetaCyc: 48% identical to Met14 (Saccharomyces cerevisiae)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.25

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WXC7 at UniProt or InterPro

Protein Sequence (202 amino acids)

>AO356_08855 adenylylsulfate kinase (Pseudomonas fluorescens FW300-N2C3)
MNETSNVSMQQAQIRPYAQALTPADRAAIKAQRPRCIWLTGLSGAGKSTLANALEVQLNQ
QGLHTSLLDGDNLRQGLCRGLGMDAESRKENIRRIAEVARLMVDAGLIVIVAAISPFRAD
REAARQLFPEGTFVEVYVSTPFDVCARRDPKGLYREACAGRIKNFTGLDSPYEAPLAPDC
AIDTSEVELAQACARLSALLQI