Protein Info for AO356_08515 in Pseudomonas fluorescens FW300-N2C3

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF00126: HTH_1" amino acids 11 to 69 (59 residues), 76.8 bits, see alignment E=9.8e-26 PF03466: LysR_substrate" amino acids 94 to 295 (202 residues), 146.1 bits, see alignment E=1e-46

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a567)

Predicted SEED Role

"Transcriptional regulator, LysR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H1T6 at UniProt or InterPro

Protein Sequence (302 amino acids)

>AO356_08515 LysR family transcriptional regulator (Pseudomonas fluorescens FW300-N2C3)
MLNKRYLPSITALQCFEAVTRHLSFTRAAEELHLTQSAVSKQVAQLEELLQHLLFRRVRR
RLQLTPAGELYLGEVRKILTQVEMSTHYLRSYGGDTEVLRVSTPPTFGARWLVPRLKGWR
LRHPKIHLDLRSEQEADDLQQGRSDLAFYFGQGSRPGTESRRLFDEELVPVCAPGSLPEQ
AFTDPTQLAELVLLQNASRPQAWHDWFDSQGYHTEHSYHGPRFETFYMCIRAAQVGCGVA
LLPRFLVEEELADGKLVIPWQHAMPSTDAYYLAYPEHSAEVPKVRLFVEWMLEQLDSPGT
PQ