Protein Info for AO356_08510 in Pseudomonas fluorescens FW300-N2C3

Annotation: aldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 19 to 478 (460 residues), 430.5 bits, E=3.4e-133

Best Hits

Swiss-Prot: 51% identical to AL7A1_BOVIN: Alpha-aminoadipic semialdehyde dehydrogenase (ALDH7A1) from Bos taurus

KEGG orthology group: K00128, aldehyde dehydrogenase (NAD+) [EC: 1.2.1.3] (inferred from 98% identity to pba:PSEBR_a568)

MetaCyc: 81% identical to L-aminoadipate-semialdehyde dehydrogenase (Pseudomonas putida)
L-aminoadipate-semialdehyde dehydrogenase. [EC: 1.2.1.31]

Predicted SEED Role

"L-pipecolate dehydrogenase (EC 1.5.99.3)" in subsystem Lysine degradation (EC 1.5.99.3)

MetaCyc Pathways

• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (7/8 steps found)
• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• mitochondrial NADPH production (yeast) (4/5 steps found)
• octane oxidation (4/5 steps found)
• phytol degradation (3/4 steps found)
• putrescine degradation III (3/4 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• L-lysine degradation V (6/9 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• serotonin degradation (4/7 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• noradrenaline and adrenaline degradation (8/13 steps found)
• dopamine degradation (2/5 steps found)
• aromatic biogenic amine degradation (bacteria) (4/8 steps found)
• L-lysine degradation II (L-pipecolate pathway) (4/9 steps found)
• L-lysine degradation XI (1/5 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• limonene degradation IV (anaerobic) (1/7 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• superpathway of L-lysine degradation (19/43 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine biosynthesis
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3 or 1.2.1.31 or 1.5.99.3

Sequence Analysis Tools

See A0A0N9WG09 at UniProt or InterPro

Protein Sequence (496 amino acids)

>AO356_08510 aldehyde dehydrogenase (Pseudomonas fluorescens FW300-N2C3)
MVAALLDRLGVNPALYQGGTQPVHSPIDGSRIGAVNWEGAAEVEQQVSRAEHAFDLWRQV
PAPRRGELVRQFGDLLREYKADLGELVSWEAGKITQEGLGEVQEMIDICDFAVGLSRQLY
GLTIASERPGHHMRESWHPLGVVGVISAFNFPVAVWAWNTTLALVCGNSVIWKPSEKTPL
TALACQALFERVLKNFNDAPPYLSQVIIGGRDAGEALVDDPRVALISATGSTRMGREVAP
KVAARFARSILELGGNNAMILAPSADLDMAVRAILFSAVGTAGQRCTTLRRLIAHESVKE
EIVTRLKAAYSKVRIGHPLEGNLVGPLIDKHSFDGMQDALEQALSEGGRVFGGKRQLEDQ
FPNAYYVSPAIVEMPEQSDVVRHETFAPILYVVGYKDFAEALHLNNAVPQGLSSCIFTTD
VREAEQFMSAVGSDCGIANVNIGPSGAEIGGAFGGEKETGGGRESGSDAWRGYMRRQTNT
VNYSLELPLAQGITFD