Protein Info for AO356_08085 in Pseudomonas fluorescens FW300-N2C3

Annotation: bile acid:sodium symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details PF13593: SBF_like" amino acids 13 to 324 (312 residues), 355.1 bits, see alignment E=3.6e-110 PF01758: SBF" amino acids 47 to 221 (175 residues), 46.1 bits, see alignment E=4.6e-16

Best Hits

Swiss-Prot: 45% identical to YFEH_ECOLI: Putative symporter YfeH (yfeH) from Escherichia coli (strain K12)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 93% identity to pba:PSEBR_a653)

Predicted SEED Role

"Sodium/bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W6C1 at UniProt or InterPro

Protein Sequence (342 amino acids)

>AO356_08085 bile acid:sodium symporter (Pseudomonas fluorescens FW300-N2C3)
MHIFRHLKRMMTDWFLCGMVLATLLAYFFPTFGATGGAMHAEWVVNIGIFVVFFLHGVNL
SGEQIRHGLKNIRLHVMVQAFTFGVFPLLWLLSNWLLGSHVPALLMLGFFYLCALPSTIS
SSVALTGSAKGNVPAAILNASLSSVLGIFLTPLLVSFVVGSGAGGIDLGSTLLDLCMMLL
LPLVLGQFLRRWLAGFFGRYKRYTSVIDKLVILLLVYAAFCNSMVSGIWRQQGNGVLLSA
VVGSAVLLAIILWATTRTARALKFNNADEVAAVFCASKKSLAAGVPMAALIFGNHPGLGL
ILLPIMIYHPLQLIVCSILAEHYANQHKALASRQEGAVVNAR