Protein Info for AO356_08045 in Pseudomonas fluorescens FW300-N2C3

Annotation: NADPH:quinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR02817: zinc-binding alcohol dehydrogenase family protein" amino acids 2 to 337 (336 residues), 564 bits, see alignment E=6.5e-174 PF08240: ADH_N" amino acids 29 to 109 (81 residues), 48.6 bits, see alignment E=1.3e-16 PF00107: ADH_zinc_N" amino acids 161 to 278 (118 residues), 47.6 bits, see alignment E=2.5e-16 PF13602: ADH_zinc_N_2" amino acids 194 to 334 (141 residues), 62.9 bits, see alignment E=9.1e-21

Best Hits

Swiss-Prot: 40% identical to ZDH1_STAAS: Zinc-type alcohol dehydrogenase-like protein SAS2087 (SAS2087) from Staphylococcus aureus (strain MSSA476)

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a662)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WPJ4 at UniProt or InterPro

Protein Sequence (337 amino acids)

>AO356_08045 NADPH:quinone reductase (Pseudomonas fluorescens FW300-N2C3)
MKAIAYYHSLPITDPQSLQDIELPEPVAGPRDLLVEVKAISVNPVDTKVRQNVQPEDGVA
KVLGWDVAGVVKAVGSEVTLFKTGDKVFYAGSIARAGGNSELHVVDERIVGHMPKTLGFA
DSAALPLTAITAWELLFERLHIQEGQDNQDQSLLIVGAAGGVGSILTQLASQLTGLKVIG
TASRAQTQEWVRNLGADLVIDHSRPLSEALKEAGQPQVTHVASLTQTDQHLDQLVEALAP
QGKLALIDDPKALDVTKLKRKSLSLHWEFMYTRSLFETADMLEQHKLLNRVAALIDAGTL
KTTVGEHFGTINAENLRRAHALLESGQSKGKIVLEGF