Protein Info for AO356_07720 in Pseudomonas fluorescens FW300-N2C3

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF00005: ABC_tran" amino acids 31 to 182 (152 residues), 114.1 bits, see alignment E=8.2e-37 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 232 to 317 (86 residues), 97.2 bits, see alignment E=2.4e-32 PF08352: oligo_HPY" amino acids 234 to 299 (66 residues), 78.5 bits, see alignment E=3.8e-26

Best Hits

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 98% identity to pba:PSEBR_a713)

Predicted SEED Role

"Peptide ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H1R7 at UniProt or InterPro

Protein Sequence (323 amino acids)

>AO356_07720 ABC transporter ATP-binding protein (Pseudomonas fluorescens FW300-N2C3)
MTLLHVKDLQVRFAAPGSGPFGINRQWVKAVNGVSLSLAAGEVLGLVGESGSGKSTLGRA
ILRLTEVSAGQILFDGVDMAQGKRIDIERLRHETAMIFQDPYTALNPRMSIGDTLAEVLR
VRCAIPASLIRQRVDELLNLVGLRPELAHRKPGSLSGGQCQRVGIARALAIEPRLIIADE
CVAALDVSIQGQIINLLLELRQRMNLAILFIAHDLAIVRRLCDRVAVMYLGEIVEQGPTE
TVFSSPRHPYTVALIQSIPHIDPTRPLLSAPLPGEPPSPLNLPSGCVFHPRCRYAQPICA
KTPPPSHDINGHRYSCVLGEPLL