Protein Info for AO356_07405 in Pseudomonas fluorescens FW300-N2C3

Annotation: ribosome-binding factor A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR00082: ribosome-binding factor A" amino acids 1 to 114 (114 residues), 115.8 bits, see alignment E=7.7e-38 PF02033: RBFA" amino acids 7 to 112 (106 residues), 124 bits, see alignment E=1.5e-40

Best Hits

Swiss-Prot: 93% identical to RBFA_PSEPF: Ribosome-binding factor A (rbfA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02834, ribosome-binding factor A (inferred from 98% identity to pba:PSEBR_a778)

Predicted SEED Role

"Ribosome-binding factor A" in subsystem NusA-TFII Cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H1R0 at UniProt or InterPro

Protein Sequence (133 amino acids)

>AO356_07405 ribosome-binding factor A (Pseudomonas fluorescens FW300-N2C3)
MAKEYSRTQRIGDQMQRELAQLIRREVKDPRVGLVTITAVEVSRDVGHAKIFITVMGQDS
AEEIAQSIKVLNSAAGFLRMQLAREMKLRSVPQLHFHYDESVARGAHLSALIERAVAQDS
QHPVAADPEDTKE