Protein Info for AO356_07265 in Pseudomonas fluorescens FW300-N2C3

Annotation: peptide transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 102 to 127 (26 residues), see Phobius details amino acids 147 to 174 (28 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 220 to 245 (26 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details PF12911: OppC_N" amino acids 18 to 70 (53 residues), 62.7 bits, see alignment 2.3e-21 PF00528: BPD_transp_1" amino acids 117 to 300 (184 residues), 108.2 bits, see alignment E=4.3e-35

Best Hits

Swiss-Prot: 65% identical to DPPC_ECO57: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli O157:H7

KEGG orthology group: K12370, dipeptide transport system permease protein (inferred from 99% identity to pba:PSEBR_a805)

MetaCyc: 65% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9X6R1 at UniProt or InterPro

Protein Sequence (303 amino acids)

>AO356_07265 peptide transporter (Pseudomonas fluorescens FW300-N2C3)
MSTPTTAVAVDQSLLYPSPYKEFWHAFSRNKGAVAGLLFMILVVFCALFAPWVAPHDPSE
QYRDFLLTPPAWLEGGQIQFLLGTDELGRDLLSRLIQGSRLSLLIGLSSVVMSLIPGILL
GLFAGFFPRILGPTIMRLMDIMLALPSLLLAVAIVAILGPGLINTVIAIAIVSLPSYVRL
TRAAVMGELNRDYVTAARLAGAGLPRLMFITVLPNCMAPLIVQATLSFSSAILDAAALGF
LGLGVQPPTPEWGTMLASARDYIERAWWVVSLPGLTILLSVLAINLMGDGLRDALDPKLK
NAA