Protein Info for AO356_07100 in Pseudomonas fluorescens FW300-N2C3

Annotation: carbon-nitrogen hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF00795: CN_hydrolase" amino acids 3 to 259 (257 residues), 182.1 bits, see alignment E=6.5e-58

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a833)

Predicted SEED Role

"FIG003879: Predicted amidohydrolase / Omega amidase (Nit2 homolog)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WWE5 at UniProt or InterPro

Protein Sequence (287 amino acids)

>AO356_07100 carbon-nitrogen hydrolase (Pseudomonas fluorescens FW300-N2C3)
MPVAVIQMVSQSDVLANLARARVLLEQAAAGGARLAVLPENFAAMGRRDIADIGRAEAFG
QGPILPWLKQVARDLKLWIVAGTLPLPPVDQPEARSHACSLLVDDQGQIVARYDKLHLFD
VDVADNRGRYRESDDYAYGANVVVADTPVGRVGLTVCYDLRFPELYSELRAAGAELITAP
SAFTAVTGAAHWDVLIRARAIETQCYVLAAAQGGVHPGPRETFGHAAIVDPWGRVLAQQD
QGEAVLVAERDSSEQASIRARMPVASHRRFFSQGARQRPVQDDEFKA