Protein Info for AO356_07075 in Pseudomonas fluorescens FW300-N2C3

Annotation: aspartate ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF00206: Lyase_1" amino acids 12 to 336 (325 residues), 315.3 bits, see alignment E=5.3e-98 PF10415: FumaraseC_C" amino acids 402 to 454 (53 residues), 75.9 bits, see alignment 2.6e-25

Best Hits

Swiss-Prot: 77% identical to FUMC2_PSEAE: Fumarate hydratase class II 2 (fumC2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 98% identity to pba:PSEBR_a838)

MetaCyc: 48% identical to fumarase C (Escherichia coli K-12 substr. MG1655)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H1Q2 at UniProt or InterPro

Protein Sequence (458 amino acids)

>AO356_07075 aspartate ammonia-lyase (Pseudomonas fluorescens FW300-N2C3)
MSNTRIERDSMGELQVPVDALYGAQTQRAVDNFPVSGQRMPAQFIRALILAKAAAARANV
ELEQISAAQGKAIVDAALGLLEGRFMDHFPVDIFQTGSGTSSNMNANEVIATLASGLLGE
AINPNDHVNCGQSSNDIIPTSIHVSAALALHEQLLPALLHLVQVIERKAEEVHPFIKTGR
THLMDAMPVRLSQVLDGWAQQLKANIGHLQDLLPSLQSLAQGGTAVGTGVNAHPRFAELF
SQQLTQLTQVQFTPGKNLFALIGSQDTAVAVSGQLKTTAVSLMKIANDLRWMNSGPLAGL
GEIELEGLQPGSSIMPGKVNPVIPEATAMVAAQVIGNDTVITIAGQSGNFELNVMLPIIA
QNLLSSIALMSTASRLLADKAIATFKVNEARLKEALSRNPILVTALNPIIGYQKAAEIAK
KAYQQGRPVIDVALEHTDLSRSELEVLLDPEKLTAGGV