Protein Info for AO356_07060 in Pseudomonas fluorescens FW300-N2C3

Annotation: divalent cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 151 to 167 (17 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details PF02535: Zip" amino acids 153 to 291 (139 residues), 67.9 bits, see alignment E=4.7e-23

Best Hits

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 98% identity to pba:PSEBR_a841)

Predicted SEED Role

"Metal transporter, ZIP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WF91 at UniProt or InterPro

Protein Sequence (296 amino acids)

>AO356_07060 divalent cation transporter (Pseudomonas fluorescens FW300-N2C3)
MDTQTLAIGSGRMFRYALGSLLLLAGMTLLAAQGLAWLDLEPRLLRALQGGGLCALGTAL
GAVPVLVIRRMPQAVSDSLLGFGAGVMLAATAFSLIVPGIAAAEQLGFTPWAASGLICFG
ILSGAFGLYLVDRKVSASPERLVAAPGRPIIAPRIWLFVFAIIAHNIPEGMAVGVSAGGG
MPDADSLAMGIALQDVPEGLVIALVLATAGMSRVRAFLIGAASGLVEPVFALLCAWLVSL
AEMLLPLGLALAAGAMLLVVTHEVIPESRRNGHEKLASLGLLVGFCLMMVLDTALA