Protein Info for AO356_06420 in Pseudomonas fluorescens FW300-N2C3

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 49 to 80 (32 residues), see Phobius details amino acids 86 to 103 (18 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details PF01595: CNNM" amino acids 12 to 149 (138 residues), 50.7 bits, see alignment E=2.6e-17 PF00571: CBS" amino acids 264 to 314 (51 residues), 31.5 bits, see alignment 2.7e-11 PF03471: CorC_HlyC" amino acids 331 to 402 (72 residues), 56 bits, see alignment E=5e-19

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a987)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WSL2 at UniProt or InterPro

Protein Sequence (413 amino acids)

>AO356_06420 transporter (Pseudomonas fluorescens FW300-N2C3)
MDTLPVAPLFAVLVVLILWSALFTAIEAAQQHLLAQRTASRASDKPLATLTFPLPSLILC
NTLCRALAVVIGTLLAIFTWLENGPWVAWLGTSAALLVFADYLPRTLATRQPDAVLALGN
TLLGIPLKILYPFAWLLNGASQLLLRPFARKPGMVQQSDDEMPAPPRSEQESEQGSGRLH
PISGIHALDNITVNDILVPRSEVDGINLDDPIGEIIEQLRLNRRTRLPVFHSDINQVEAV
LNTRQIRHLLADASLTKEALLAASHEPYFVPESTPLQLQLLNFHKQQRRLGMVVDEYGEV
LGIVTLEDILEEIVGEFESQHSLDNPHVHPQPDGRLMIDGAASIRELNRTLGWHLPCDGP
KTLNGLVTEALETIPESPVCLKIGRYRLEIIETVDNRVSQVLAWHNSSVPTAL