Protein Info for AO356_06375 in Pseudomonas fluorescens FW300-N2C3

Annotation: homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03447: NAD_binding_3
  • amino acids 10 to 127 (118 residues), 77.2 bits, E=2.4e-25
• PF00742: Homoserine_dh
  • amino acids 135 to 313 (179 residues), 221.8 bits, E=8.4e-70
• PF01842: ACT
  • amino acids 352 to 416 (65 residues), 53.1 bits, E=3.2e-18

Best Hits

Swiss-Prot: 89% identical to DHOM_PSEAE: Homoserine dehydrogenase (hom) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 99% identity to pba:PSEBR_a996)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.3

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

See A0A0N7H1N5 at UniProt or InterPro

Protein Sequence (434 amino acids)

>AO356_06375 homoserine dehydrogenase (Pseudomonas fluorescens FW300-N2C3)
VNPVKVGICGLGTVGGGTFNVLQRNAEEISRRAGRGIEVAQIAMRTPKPQFQTTGIAITN
DVFEVATNPEIDIVIELVGGYTVARELVLKAIENGKHVVTANKALIAVHGNEIFAKAREK
GVIVAFEAAVAGGIPVIKAIREGLSANRINWVAGIINGTGNFILTEMREKGRTFEDVLAE
AQALGYAEADPTFDVEGIDAAHKLTILASIAFGIPLQFDKAYTEGITQLTTADVNYAEAL
GYRIKHLGVARSTASGIELRVHPTLIPADRLIANVNGVMNAVMVNGDASGSTLFYGAGAG
MEPTASSVIADLVDVVRAMTSDPENRVPHLAFQPDSLSAHPILPIEACESSYYLRIQAKD
HPGVLAQVASILSERGINIESIMQKEVEEHDGLVPMILLTHRVVEQSINDAIAALEALQG
VVGPVVRIRVEHLN