Protein Info for AO356_06015 in Pseudomonas fluorescens FW300-N2C3

Annotation: phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01148: CTP_transf_1
  • amino acids 3 to 264 (262 residues), 223.8 bits, E=1.8e-70

Best Hits

Swiss-Prot: 71% identical to CDSA_PSEAE: Phosphatidate cytidylyltransferase (cdsA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 96% identity to pba:PSEBR_a1070)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Phosphatidylinositol signaling system

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.41

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

See A0A0N9W552 at UniProt or InterPro

Protein Sequence (268 amino acids)

>AO356_06015 phosphatidate cytidylyltransferase (Pseudomonas fluorescens FW300-N2C3)
MLKQRIITALILLPIALGGFFLLDGGSFALFIGLVVTLGAWEWARLAGFPAQSARVTYAV
AVAAMLFIMYVVPGLAPWVLGAAVLWWATATFLVLTYPRTTHHWANTATKLVIGLLILLP
AWQGLIWIKQGPLGNWQIMAVMVLVWGADVGAYFSGRAFGKRKLAPQVSPGKSWEGVYGG
LVLSLVITTVVGFVRDWTVAQLFIGLIGAALIVFVSVVGDLTESMFKRQSGIKDSSNLLP
GHGGVLDRIDSLTAAIPIFAVLLWMAAS