Protein Info for AO356_05930 in Pseudomonas fluorescens FW300-N2C3

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 90% identical to ISPD_PSEPF: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 96% identity to pba:PSEBR_a1087)

MetaCyc: 50% identical to 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase. [EC: 2.7.7.60]

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
taxadiene biosynthesis (engineered) (11/13 steps found)
methylerythritol phosphate pathway I (8/9 steps found)
methylerythritol phosphate pathway II (8/9 steps found)
isoprene biosynthesis I (8/10 steps found)
superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WVS3 at UniProt or InterPro

Protein Sequence (235 amino acids)

>AO356_05930 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Pseudomonas fluorescens FW300-N2C3)
MSMRLPAFWAVIPAAGVGARMAADRPKQYLQLGGRTILEHSLGCFLDHPTVKGVVVSLAH
DDPYWPTLACASDTRIQRVDGGEQRSDSVLNALLHLHGQGADDHDWVLVHDAARPNLARA
DLDTLLSELANDPVGGLLAVPARDTLKRVDKHGRVLETVDRSVIWQAYTPQMFRLGALHR
ALANSLVADAVITDEASAMEWAGQAPRLIEGRSDNIKVTRPEDLEWLRQRWANRH