Protein Info for AO356_05515 in Pseudomonas fluorescens FW300-N2C3

Updated annotation (from data): ABC transporter for L-Lysine, ATPase component
Rationale: Specific phenotype on L-Lysine. Note that this organism has a second ABC transporter operon that is also important for lysine utilization, which is not explained.
Original annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 19 to 178 (160 residues), 125.1 bits, E=3.3e-40

Best Hits

Swiss-Prot: 68% identical to HISP_ECOLI: Histidine transport ATP-binding protein HisP (hisP) from Escherichia coli (strain K12)

KEGG orthology group: K10017, histidine transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 98% identity to pba:PSEBR_a1151)

Predicted SEED Role

"Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21

Sequence Analysis Tools

See A0A0N9WEE5 at UniProt or InterPro

Protein Sequence (254 amino acids)

>AO356_05515 ABC transporter for L-Lysine, ATPase component (Pseudomonas fluorescens FW300-N2C3)
MYKLTIEGLHKSYGEHEVLKGVSLKAKTGDVISLIGASGSGKSTFLRCINFLEQPNDGAM
TLDGQPVQMIKDRHGMHVADADELQRIRTRLAMVFQHFNLWSHMTVLENITMAPRRVLGV
SKQEADDRARRYLDKVGLPARVAEQYPAFLSGGQQQRVAIARALAMEPEVMLFDEPTSAL
DPELVGEVLKVIQGLAEEGRTMIMVTHEMSFARKVSNQVLFLHQGLVEEEGAPEDVLGNP
KSERLKQFLSGNLK