Protein Info for AO356_05235 in Pseudomonas fluorescens FW300-N2C3

Annotation: glycerol-3-phosphate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 91 to 104 (14 residues), see Phobius details PF16220: DUF4880" amino acids 19 to 58 (40 residues), 48.7 bits, see alignment 7.9e-17 PF04773: FecR" amino acids 115 to 205 (91 residues), 61.3 bits, see alignment E=1.5e-20 PF16344: FecR_C" amino acids 249 to 297 (49 residues), 28.4 bits, see alignment 2e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a1205)

Predicted SEED Role

"Iron siderophore sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WUP3 at UniProt or InterPro

Protein Sequence (318 amino acids)

>AO356_05235 glycerol-3-phosphate ABC transporter substrate-binding protein (Pseudomonas fluorescens FW300-N2C3)
VTDNSPSPAPTPETAHAMEQALDWLILLDSPSEEQTRQFQAWLAADPRHGEAFARAQAIW
NGPQVMASARRLETAPKVTALSRLRAHWKPLATAAVLFLGLFNFSDLPLRLQADHLTVVG
ERQRLQLEDGSKVLLNTDSAFSSTFNEQRYVARLYKGEAFFEVPGNRTLPLEIDAGPVTA
SVSDTTFAVRYLDGVAQVQVQRGDVDLRANRNDTHVRLSAGESIRIGPNGFDRPARLDAN
TDLAWVQGRLVFENRPLSQVLAELRRYYPGWIINSNEQLANVAVTGNYRLDQPLDVVRSL
AHITSARLQEFPALVILN