Protein Info for AO356_05145 in Pseudomonas fluorescens FW300-N2C3

Annotation: class V aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF00266: Aminotran_5" amino acids 57 to 357 (301 residues), 91.3 bits, see alignment E=9.5e-30 PF00155: Aminotran_1_2" amino acids 66 to 208 (143 residues), 27.6 bits, see alignment E=2.6e-10 PF01041: DegT_DnrJ_EryC1" amino acids 77 to 210 (134 residues), 22.2 bits, see alignment E=1.1e-08

Best Hits

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a1222)

Predicted SEED Role

"Isopenicillin N epimerase (EC 5.1.1.17)" (EC 5.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WV98 at UniProt or InterPro

Protein Sequence (395 amino acids)

>AO356_05145 class V aminotransferase (Pseudomonas fluorescens FW300-N2C3)
MPENTLRAHDEAFWRTFVDRYDIDPNGPLNLENGYFGRMSRTVVEEYQRNIEFINRGNSV
YVRQQFDQEHGEAIRRQVARLIHASPQSVTLANSAVDALQTLIRNYNGLKPGDQVLICDV
EYASVKSAMRWLARQRGVEVIEIVHQHPASFDSLVSTYREAFIRYPRLKLMALTYVNHLT
GLVMPVQAIAENAREFAVDIILDGAHALGQIDFDLKKLGIEFAGFNLQKWIGGPLSQGFL
YIAPQRLADIDPDMDEDNYPATDIRSRTPHSTPNIPALLTLPLVFEEHRSLGGALAKGPR
LCYLRDLWVNAVRDVPGIEVMTPDDRRLYCGITAMRFTNQADQQAMAARLLDEHGIFTVV
RPTSVGPCIRITPGLITLASDIERLTEALIHLSRT