Protein Info for AO356_04995 in Pseudomonas fluorescens FW300-N2C3

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03298: transcriptional regulator, ArgP family" amino acids 2 to 292 (291 residues), 373.7 bits, see alignment E=2.7e-116 PF00126: HTH_1" amino acids 5 to 62 (58 residues), 52.8 bits, see alignment E=3.1e-18 PF03466: LysR_substrate" amino acids 89 to 274 (186 residues), 51.1 bits, see alignment E=1.2e-17

Best Hits

Swiss-Prot: 91% identical to ARGP_PSEPF: HTH-type transcriptional regulator ArgP (argP) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 97% identity to pba:PSEBR_a1253)

Predicted SEED Role

"Chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WRT6 at UniProt or InterPro

Protein Sequence (302 amino acids)

>AO356_04995 LysR family transcriptional regulator (Pseudomonas fluorescens FW300-N2C3)
MFDYKLLSALAAVVEQAGFERAAQVLGLSQSAISQRIKLLEARVGQPVLVRATPPAPTEI
GRRLLNHVQQVRLLERDLQSLVPALDEEGLPERLRIALNADSLATWWAAAVGDFCADHHL
LLDLVVEDQTVGLKRMRAGEVAACVCASERPVAGARSVLLGAMRYRALASPAFIARHFPD
GVRADQLARTPALVFGPDDFLQHRYLASVGVEGGFEHHLCPSSEGFIRLAEVGLGWGLVP
ELQVREQLERGVLVELLADKPIDVPLYWHHWRNGGQLLGLLTERLIAAASSTLQAVSEKR
LA