Protein Info for AO356_04750 in Pseudomonas fluorescens FW300-N2C3

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 TIGR00229: PAS domain S-box protein" amino acids 10 to 122 (113 residues), 81.1 bits, see alignment E=7.3e-27 PF00989: PAS" amino acids 13 to 95 (83 residues), 56.5 bits, see alignment E=1.1e-18 PF08448: PAS_4" amino acids 17 to 119 (103 residues), 55.6 bits, see alignment E=2.3e-18 PF13426: PAS_9" amino acids 18 to 116 (99 residues), 48.9 bits, see alignment E=2.7e-16 PF08447: PAS_3" amino acids 30 to 99 (70 residues), 56.6 bits, see alignment E=1e-18 PF13185: GAF_2" amino acids 161 to 277 (117 residues), 45.1 bits, see alignment E=4.8e-15 PF01590: GAF" amino acids 162 to 276 (115 residues), 40.4 bits, see alignment E=1.6e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 285 to 443 (159 residues), 144.9 bits, see alignment E=1.9e-46 PF00990: GGDEF" amino acids 289 to 443 (155 residues), 155.6 bits, see alignment E=3.8e-49

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a1304)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WMR6 at UniProt or InterPro

Protein Sequence (449 amino acids)

>AO356_04750 diguanylate cyclase (Pseudomonas fluorescens FW300-N2C3)
MDTSSSAPLASYIDLLLDAVCAVDGQGRFVFVSAACERIFGYTPQELIGQPMIDLVHPAD
RQRTLEAAREIMEGEPKLNFENRYLRKDGRVVHILWSARWSPVDQLRIAVARDITERKQA
ESRQAALYAISEAAHAAADLLALFKRVHLIIGEWLPALNFSVALYDEQCSQLNFPYHVDD
REGQPELPGTVTGRLCAEVIRSGQPILLTPGGNSLPAGFDDLVAQPDAPCWLGVPLNSQN
GTIGALIVKSAPDNERYTEQDKELLQYVCAQITIAIERKQLHARLQHMAQYDQLTQVPNR
ELLRERFKCALATARAASGRMALLYIDLDRFKQVNDTYGHGVGDMLLQAVANRIKGCIRD
TDTVARIGGDEFVVLLHSIQALEDAHSVQEKIHHALAQPLRLDGHCLSIEPSIGVACFPD
HGTEDIALFRHADEAMYAAKRHNHRAFGI