Protein Info for AO356_03845 in Pseudomonas fluorescens FW300-N2C3

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 PF00072: Response_reg" amino acids 5 to 114 (110 residues), 97.1 bits, see alignment E=2.3e-31 PF00158: Sigma54_activat" amino acids 133 to 295 (163 residues), 235.6 bits, see alignment E=7.8e-74 PF14532: Sigma54_activ_2" amino acids 144 to 295 (152 residues), 69.7 bits, see alignment E=9.7e-23 PF00004: AAA" amino acids 153 to 272 (120 residues), 22.4 bits, see alignment E=4.5e-08 PF07728: AAA_5" amino acids 153 to 271 (119 residues), 29.4 bits, see alignment E=2.3e-10 PF02954: HTH_8" amino acids 410 to 449 (40 residues), 50 bits, see alignment 6.2e-17

Best Hits

KEGG orthology group: K10943, two component system, response regulator FlrC (inferred from 96% identity to pba:PSEBR_a1476)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WDL4 at UniProt or InterPro

Protein Sequence (464 amino acids)

>AO356_03845 Fis family transcriptional regulator (Pseudomonas fluorescens FW300-N2C3)
MAIKVLLVEDDRALREALADTLVLAGHDYAAVGSAEEALQAVGREAFSLVVSDVNMPGMD
GHQLLGLLRARQPQLPVLLMTAHGAVERAVDAMRQGAADYLVKPFEPKALLDLVARHALG
SLAVEGEGPVAIEPASAQLLELASRVARSDSTVLISGESGTGKEVLARYIHQQSRRAGEP
FIAINCAAIPDNMLEATLFGHEKGSFTGAIAAQAGKFEQADGGTILLDEISEMPLGLQAK
LLRVLQEREVERVGARKPISLDIRVVATTNRDLAGEVAAGRFREDLYYRLSVFPLAWRPL
RERTADILPLAERLLNKHVNKMKHAAARLSAEARACLVAYPWPGNVRELDNAIQRALILQ
QGGLIQPEDFCLAGPVACAPLPALAPAPTATPVPPMDVEGDSVGALGDDLRRREFQMIID
TLRAERGRRKEAAERLGISPRTLRYKLAQMRDAGMDVEAYLFAS