Protein Info for AO356_03825 in Pseudomonas fluorescens FW300-N2C3

Annotation: flagellar assembly protein FliH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 PF02108: FliH" amino acids 101 to 223 (123 residues), 118.9 bits, see alignment E=7.3e-39

Best Hits

KEGG orthology group: K02411, flagellar assembly protein FliH (inferred from 95% identity to pba:PSEBR_a1480)

Predicted SEED Role

"Flagellar assembly protein FliH" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H1H4 at UniProt or InterPro

Protein Sequence (281 amino acids)

>AO356_03825 flagellar assembly protein FliH (Pseudomonas fluorescens FW300-N2C3)
MSAKSDEAPSDLIRARDVGGFDVWSLPSFDPHVPEPEPEPVEELPEMEEVPLEEVQPLTL
EEVESIRQEAYNEGFAVGEKEGFHSTTLKVRQEADVALTAKLRALESLMLNLFDPIAEQD
TQIEKSLVGLVQHIAKQVIQRELAIDSSQIEHVMREALKLLPLGVGNVRLYINPQDFELV
KALRERHEETWRIVEDAALLPGGCRVETEHSRIDATVETRISQIMAKLFDQLHEQALHPA
AADLSLELPDDPQISADAAPADVELEVPELDASVPDNRDAP