Protein Info for AO356_03650 in Pseudomonas fluorescens FW300-N2C3

Annotation: heme ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 58 to 85 (28 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 15 to 185 (171 residues), 118.5 bits, see alignment E=1.7e-38 TIGR01191: heme exporter protein CcmC" amino acids 46 to 229 (184 residues), 274.4 bits, see alignment E=2.4e-86

Best Hits

Swiss-Prot: 83% identical to CCMC_PSEAE: Heme exporter protein C (ccmC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02195, heme exporter protein C (inferred from 99% identity to pba:PSEBR_a1513)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W3W1 at UniProt or InterPro

Protein Sequence (251 amino acids)

>AO356_03650 heme ABC transporter permease (Pseudomonas fluorescens FW300-N2C3)
MNWTWFHKLGSPKWFYGISGKMLPWLSIAALLLIGSGVVWGLAFAPPDYQQGNSFRIIYI
HVPTAMLAQSIYVMLAVCGVVGLVWKMKLADVALQCAAPIGGWMTAVALVTGAIWGKPTW
GSWWVWDARLTSMLILLFLYFGLIALGNAISNRDSAAKACAVLAIVGVINIPIIKYSVEW
WNTLHQGATFTLTEKPAMPVEMWLPLLLTVLGFYCFFGAVLLLRMRLEVLKRESRASWVK
AEVQNSLEAAR