Protein Info for AO356_03490 in Pseudomonas fluorescens FW300-N2C3

Annotation: 3-demethylubiquinone-9 3-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 8 to 225 (218 residues), 292.8 bits, E=7.2e-92
• PF05724: TPMT
  • amino acids 17 to 86 (70 residues), 26.6 bits, E=3.1e-09
• PF06325: PrmA
  • amino acids 35 to 151 (117 residues), 37 bits, E=1.8e-12
• PF01728: FtsJ
  • amino acids 38 to 119 (82 residues), 25.1 bits, E=1e-08
• PF02353: CMAS
  • amino acids 42 to 170 (129 residues), 40 bits, E=2e-13
• PF01209: Ubie_methyltran
  • amino acids 43 to 173 (131 residues), 42.9 bits, E=2.5e-14
• PF13489: Methyltransf_23
  • amino acids 45 to 199 (155 residues), 87.2 bits, E=7e-28
• PF08003: Methyltransf_9
  • amino acids 45 to 151 (107 residues), 24.2 bits, E=1.1e-08
• PF05175: MTS
  • amino acids 47 to 118 (72 residues), 24.9 bits, E=9.6e-09
• PF07021: MetW
  • amino acids 47 to 136 (90 residues), 23.8 bits, E=2.1e-08
• PF13847: Methyltransf_31
  • amino acids 48 to 152 (105 residues), 66.7 bits, E=1.3e-21
• PF13649: Methyltransf_25
  • amino acids 51 to 144 (94 residues), 68.8 bits, E=3.5e-22
• PF08242: Methyltransf_12
  • amino acids 52 to 145 (94 residues), 60.7 bits, E=1.2e-19
• PF08241: Methyltransf_11
  • amino acids 52 to 148 (97 residues), 77.2 bits, E=8.1e-25

Best Hits

Swiss-Prot: 98% identical to UBIG_PSEFS: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 99% identity to pba:PSEBR_a1545)

MetaCyc: 64% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (11/12 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (7/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (5/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

See A0A0N9WM27 at UniProt or InterPro

Protein Sequence (232 amino acids)

>AO356_03490 3-demethylubiquinone-9 3-methyltransferase (Pseudomonas fluorescens FW300-N2C3)
MSNVDHAEIAKFEALAHRWWDRESEFKPLHDINPLRVNWIDERVNLAGKKVLDVGCGGGI
LSEAMAQRGATVMGIDMGEAPLAVAQLHQLESGVSVEYRQITAEALAEEMPGQFDVVTCL
EMLEHVPDPSSVIRACFSMVKPGGQVFFSTINRNPKAYLFAIIGAEYIMKLLPRGTHDFK
KFIRPSELGAWSRAAGLTVKDIIGLTYNPLTKHYKLAADVDVNYMIQTLREE