Protein Info for AO356_03400 in Pseudomonas fluorescens FW300-N2C3
Annotation: aminotransferase DegT
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 81% identical to WBPE_PSEAE: UDP-2-acetamido-2-deoxy-3-oxo-D-glucuronate aminotransferase (wbpE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K13017, UDP-3-keto-D-GlcNAcA aminotransferase [EC: 2.6.1.-] (inferred from 79% identity to acd:AOLE_19120)MetaCyc: 81% identical to UDP-2-acetamido-2-deoxy-ribo-hexuluronate aminotransferase (Pseudomonas aeruginosa PAO1)
RXN-13596 [EC: 2.6.1.98]
Predicted SEED Role
"Glutamate--UDP-2-acetamido-2-deoxy-D-ribohex-3-uluronic acid aminotransferase (PLP cofactor)"
MetaCyc Pathways
- UDP-2,3-diacetamido-2,3-dideoxy-α-D-mannuronate biosynthesis (5/5 steps found)
- superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (13/24 steps found)
KEGG Metabolic Maps
- Aminophosphonate metabolism
- Arginine and proline metabolism
- Caprolactam degradation
- Lysine biosynthesis
- Lysine degradation
- Methionine metabolism
- Nucleotide sugars metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.-
Use Curated BLAST to search for 2.6.1.- or 2.6.1.98
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9X4Q1 at UniProt or InterPro
Protein Sequence (360 amino acids)
>AO356_03400 aminotransferase DegT (Pseudomonas fluorescens FW300-N2C3) MIEFIDLKSQQARIKDKIDAGIQRVLSHGQYILGPEVAELEEKLAQFVGAKHCITCANGT DALQIAQMALGIGPGDEVITPGFTYIATAETVALLGAKPVYVDIDPRTYNLDPQKLEAAI TPRTKAIIPVSLYGQCADYDAINAIAVKYSIPVIEDAAQSFGATYKGKRSCNLTTIACTS FFPSKPLGCYGDGGAIFTNDDELAKVLRQIARHGQDRRYHHVRVGVNSRLDTLQAAILLP KLEIFEKELEQRQRVARLYGESLEALGVKTIPYVEEWNTSAYAQYTILVDERDQLQDKLK KQGIPTAVHYPIPLNKQPAVADANAHLPTGDRVAEQVMSLPMHPYLGDEAVAIICAAVAG