Protein Info for AO356_02880 in Pseudomonas fluorescens FW300-N2C3

Annotation: dihydroneopterin aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 115 to 178 (64 residues), 31.2 bits, see alignment E=2.4e-11 PF13098: Thioredoxin_2" amino acids 120 to 252 (133 residues), 45.2 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 68% identical to DSBG_PSEAE: Thiol:disulfide interchange protein DsbG (dsbG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03805, thiol:disulfide interchange protein DsbG (inferred from 97% identity to pba:PSEBR_a1669)

Predicted SEED Role

"Thiol:disulfide interchange protein DsbG precursor" in subsystem Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N7H1F1 at UniProt or InterPro

Protein Sequence (255 amino acids)

>AO356_02880 dihydroneopterin aldolase (Pseudomonas fluorescens FW300-N2C3)
MPRLRHLLTLAVAAALSQAPLLQAEELPAAIKKIEAKGAKIVGTFEAPDGLRGYAAQYQN
RGMALYLTPDGQHVLLGNLYDAEGKDLSAEPLQKLVYAPMAKAIWAKMEASNWIADGNKD
APRTVYLFSDPNCPYCNMFWEQARPWVKAGKVQLRHIMVGIIREDSPGKSAALLAAKDPE
KTLAEHEKAGKGSTLKPLKDIPPAIQAKLDANQQLMDELELSATPAIFYLDDKGDLQQQQ
GAPSPDKLVKILGPK